Acetylserotonin O-methyltransferase
| acetylserotonin O-methyltransferase | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Mã định danh (ID) | |||||||||
| Mã EC | 2.1.1.4 | ||||||||
| Mã CAS | 9029-77-0 | ||||||||
| Các dữ liệu thông tin | |||||||||
| IntEnz | IntEnz view | ||||||||
| BRENDA | BRENDA entry | ||||||||
| ExPASy | NiceZyme view | ||||||||
| KEGG | KEGG entry | ||||||||
| MetaCyc | chu trình chuyển hóa | ||||||||
| PRIAM | profile | ||||||||
| Các cấu trúc PDB | RCSB PDB PDBj PDBe PDBsum | ||||||||
| Bản thể gen | AmiGO / EGO | ||||||||
| |||||||||
N-Acetylserotonin O-methyltransferase, viết tắt: ASMT, là một enzyme xúc tác phản ứng cuối cùng trong sinh tổng hợp melatonin: chuyển normelatonin thành melatonin. Phản ứng này tồn tại trong con đường chuyển hóa tryptophan tổng quát. Ngoài con đường trên, enzyme còn xúc tác cho phản ứng thứ hai trong quá trình chuyển hóa tryptophan: chuyển đổi 5-hydroxy-indoleaxetat thành 5-methoxy-indoleaxetat, cùng với enzyme n-acetylserotonin-O-methyltransferase-like-protein.[3]
Ở người enzyme ASMT được mã hóa bởi các gen ASMT nằm trên vùng giả NST thường (pseudoautosomal region). Một bản sao tồn tại ở gần phần cuối nhánh ngắn của cả nhiễm sắc thể X và nhiễm sắc thể Y.[4][5]
Cấu trúc và vị trí gen
[sửa | sửa mã nguồn]N-Acetylserotonin O-methyltransferase là một loại enzyme được mã hóa bởi các gen nằm trên vùng giả NST thường của nhiễm sắc thể X và Y, và tìm thấy nhiều ở tuyến tùng và võng mạc của con người.
Mặc dù cấu trúc chính xác của N-Acetylserotonin O-methyltransferase vẫn chưa được xác định bằng nhiễu xạ X quang, nhưng đã khám phá được cấu trúc tinh thể thuộc miền Maf của '' N-Acetylserotonin O-methyltransferase''-like-protein.[6]
Lớp enzyme và chức năng
[sửa | sửa mã nguồn]Phân loại N-Acetylserotonin O-methyltransferase theo ba loại nhóm chức enzyme: transferase, chất chuyển nhóm một carbon và methyltransferase.
Danh pháp đồng nghĩa
[sửa | sửa mã nguồn]Danh pháp đồng nghĩa của N- Acetylserotonin O-methyltransferase là Hydroxyindole O-methyltransferase (HIOMT), Acetylserotonin O-methyltransferase (ASMT), Acetylserotonin N-methyltransferase, Acetylserotonin N-methyltransferase, Acetylserotonin Danh pháp đồng nghĩa được sử dụng phổ biến nhất là Hydroxyindole O-methyltransferase (HIOMT).
Sinh vật
[sửa | sửa mã nguồn]N- Acetylserotonin O-methyltransferase tìm thấy ở cả sinh vật nhân sơ và sinh vật nhân thực. Enzyme được tìm thấy trong vi khuẩn Rhodopirellula baltica và Chromobacterium violaceum. Enzyme cũng được tìm thấy trong các sinh vật nhân thực sau: Gallus gallus (gà), Bos taurus (bò), Homo sapiens (người), Macaca mulatta (khỉ rhesus) và Rattus norvegicus (chuột).
Trình tự amino acid
[sửa | sửa mã nguồn]Enzyme trong bò Bos taurus có 350 amino acid và trình tự amino acid là:
MCSQEGEGYSLLKEYANAFMVSQVLFAACELGVFELLAEALEPLDSAAVSSHLGSSPGD RAATEHLCVPEAAASRREGRKSCVCKHGARQHLPGERQPQVPAGHAAVRGQDRLRLLAP PGEAVREGRNQYLKAFGIPSEELFSAIYRSEDERLQFMQGLQDVWRLEGATVLAAFDLS PFPLICDLGGGSGALAKACVSLYPGCRAIVFDIPGVVQIAKRHFSASEDERISFHEGDF FKDALPEADLYILARVLHDWTDAKCSHLLQRVYRACRTGGGILVIESLLDTDGRGPLTT LLYSLNMLVQTEGRERTPGRSTARSVGPAASETCGDGGRGEPTMLSWPGNQACSV
Đối với Homo sapiens (người), enzyme có 373 amino acid, trình tự là:
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHG TELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWG HLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDL SVFPLMCDLGGTRIKLETIILSKLSQGQKTKHRVFSLIGGAGALAKECMSLYPGCKITV FDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLE RIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGF RDFQFKKTGAIYDAILARK
Ý nghĩa lâm sàng
[sửa | sửa mã nguồn]U
[sửa | sửa mã nguồn]Có bằng chứng về biểu hiện gen HIOMT cao trong các khối u nhu mô (PPTs). Một cuộc nghiên cứu về sự thay đổi biểu hiện gen như một dấu hiệu chẩn đoán cho các khối u. Nồng độ HIOMT cao bất thường trong các tuyến có thể đóng vai trò là dấu hiệu cho thấy sự tồn tại của các khối u nhu mô trong não.[7]
Xem thêm
[sửa | sửa mã nguồn]Nguồn tham khảo
[sửa | sửa mã nguồn]- ^ a b c GRCh38: Ensembl release 89: ENSG00000196433 - Ensembl, May 2017
- ^ “Human PubMed Reference:”.
- ^ Kanehisa M.; Goto S.; Hattori M.; Aoki-Kinoshita K.F.; Itoh M.; Kawashima S.; Katayama T.; Araki M.; Hirakawa M.; và đồng nghiệp (2006). “From genomics to chemical genomics: new developments in KEGG”. Nucleic Acids Res. 34 (90001): D354–357. doi:10.1093/nar/gkj102. PMC 1347464. PMID 16381885. [See also comments in Thomson's website]
- ^ Donohue SJ, Roseboom PH, Illnerova H, Weller JL, Klein DC (tháng 10 năm 1993). “Human hydroxyindole-O-methyltransferase: presence of LINE-1 fragment in a cDNA clone and pineal mRNA”. DNA Cell Biol. 12 (8): 715–27. doi:10.1089/dna.1993.12.715. PMID 8397829.
- ^ Rodriguez IR, Mazuruk K, Schoen TJ, Chader GJ (tháng 12 năm 1994). “Structural analysis of the human hydroxyindole-O-methyltransferase gene. Presence of two distinct promoters”. J. Biol. Chem. 269 (50): 31969–77. PMID 7989373. Bản gốc lưu trữ ngày 4 tháng 10 năm 2003. Truy cập ngày 30 tháng 12 năm 2019.
- ^ PDB: 2P5X; Min J, Wu H, Dombrovski L, Loppanu P, Weigelt J, Sundstrom M, Arrowsmith CH, Edwards AM, Bochkarve A, Plotnikov AM, Crystal Structure of Maf Domain of Human N- Acetylseratonin O-methyltransferase, Structural Genomics Consortium (SGC) (2007)
- ^ Fèvre-Montange M, Champier J, Szathmari A, Wierinckx A, Mottolese C, Guyotat J, Figarella-Branger D, Jouvet A, Lachuer J (tháng 7 năm 2006). “Microarray analysis reveals differential gene expression patterns in tumors of the pineal region”. J. Neuropathol. Exp. Neurol. 65 (7): 675–84. doi:10.1097/01.jnen.0000225907.90052.e3. PMID 16825954.
Đọc thêm
[sửa | sửa mã nguồn]- Itoh MT, Hosaka T, Mimuro T, và đồng nghiệp (2003). “Gonadotropin-releasing hormone increases melatonin release in the pineal gland of the female rat in vitro”. Horm. Metab. Res. 35 (3): 153–7. doi:10.1055/s-2003-39076. PMID 12734775.
- Ross MT, Grafham DV, Coffey AJ, và đồng nghiệp (2005). “The DNA sequence of the human X chromosome”. Nature. 434 (7031): 325–37. doi:10.1038/nature03440. PMC 2665286. PMID 15772651.
- Fukuda T, Akiyama N, Ikegami M, và đồng nghiệp (2010). “Expression of hydroxyindole-O-methyltransferase enzyme in the human central nervous system and in pineal parenchymal cell tumors”. J. Neuropathol. Exp. Neurol. 69 (5): 498–510. doi:10.1097/NEN.0b013e3181db7d3c. PMID 20418777.
- Donohue SJ, Roseboom PH, Illnerova H, và đồng nghiệp (1993). “Human hydroxyindole-O-methyltransferase: presence of LINE-1 fragment in a cDNA clone and pineal mRNA”. DNA Cell Biol. 12 (8): 715–27. doi:10.1089/dna.1993.12.715. PMID 8397829.
- Toma C, Rossi M, Sousa I, và đồng nghiệp (2007). “Is ASMT a susceptibility gene for autism spectrum disorders? A replication study in European populations”. Mol. Psychiatry. 12 (11): 977–9. doi:10.1038/sj.mp.4002069. PMID 17957233.
- Gerhard DS, Wagner L, Feingold EA, và đồng nghiệp (2004). “The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)”. Genome Res. 14 (10B): 2121–7. doi:10.1101/gr.2596504. PMC 528928. PMID 15489334.
- Jonsson L, Ljunggren E, Bremer A, và đồng nghiệp (2010). “Mutation screening of melatonin-related genes in patients with autism spectrum disorders”. BMC Med. Genom. 3: 10. doi:10.1186/1755-8794-3-10. PMC 3020629. PMID 20377855.
- Holt R, Barnby G, Maestrini E, và đồng nghiệp (2010). “Linkage and candidate gene studies of autism spectrum disorders in European populations”. European Journal of Human Genetics. 18 (9): 1013–1019. doi:10.1038/ejhg.2010.69. PMC 2987412. PMID 20442744.
- Gałecki P, Szemraj J, Bartosz G, Bieńkiewicz M, và đồng nghiệp (2010). “Single-nucleotide polymorphisms and mRNA expression for melatonin synthesis rate-limiting enzyme in recurrent depressive disorder”. J. Pineal Res. 48 (4): 311–7. doi:10.1111/j.1600-079X.2010.00754.x. PMID 20433639.
- Yi H, Donohue SJ, Klein DC, McBride OW (1993). “Localization of the hydroxyindole-O-methyltransferase gene to the pseudoautosomal region: implications for mapping of psychiatric disorders”. Hum. Mol. Genet. 2 (2): 127–31. doi:10.1093/hmg/2.2.127. PMID 8098975.
- Sato T, Deguchi T, Ichikawa T, và đồng nghiệp (1991). “Localization of hydroxyindole O-methyltransferase-synthesizing cells in bovine epithalamus: immunocytochemistry and in-situ hybridization”. Cell Tissue Res. 263 (3): 413–8. doi:10.1007/BF00327275. PMID 1878930.
- Strausberg RL, Feingold EA, Grouse LH, và đồng nghiệp (2002). “Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences”. Proc. Natl. Acad. Sci. U.S.A. 99 (26): 16899–903. doi:10.1073/pnas.242603899. PMC 139241. PMID 12477932.
- Rodriguez IR, Mazuruk K, Schoen TJ, Chader GJ (1994). “Structural analysis of the human hydroxyindole-O-methyltransferase gene. Presence of two distinct promoters”. J. Biol. Chem. 269 (50): 31969–77. PMID 7989373.
- Stefulj J, Hörtner M, Ghosh M, và đồng nghiệp (2001). “Gene expression of the key enzymes of melatonin synthesis in extrapineal tissues of the rat”. J. Pineal Res. 30 (4): 243–7. doi:10.1034/j.1600-079X.2001.300408.x. PMID 11339514.
- Melke J, Goubran Botros H, Chaste P, và đồng nghiệp (2008). “Abnormal melatonin synthesis in autism spectrum disorders”. Mol. Psychiatry. 13 (1): 90–8. doi:10.1038/sj.mp.4002016. PMC 2199264. PMID 17505466.
Liên kết ngoài
[sửa | sửa mã nguồn]- MeSH Acetylserotonin+N-Methyltransferase
- MeSH ASMTL+protein,+human
- Vị trí bộ gen ASMT ở người và thông tin chi tiết về gen ASMT có sẵn trên UCSC Genome Browser.